| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | REPIN1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The REPIN1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to REPIN1. This antibody reacts with human. The REPIN1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human REPIN1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGAQAPGRAHRCAHCRRHFPGWVALWLHTRRCQARLPLPCPE |
|---|
| Other Names | 60 kDa origin-specific DNA-binding protein, 60 kDa replication initiation region protein, ATT-binding protein, DHFR oribeta-binding protein RIP60, H_DJ0584D14.12, replication initiation region protein (60kD), replication initiator 1, RIP60AP4, Zfp464, Zinc finger protein 464, zinc finger protein 464 (RIP60), zinc finger protein AP4, zinc finger proten AP4, ZNF464 |
|---|
| Gene, Accession # | REPIN1, Gene ID: 29803 |
|---|
| Catalog # | NBP1-89059 |
|---|
| Price | |
|---|
| Order / More Info | REPIN1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|