| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAP1S |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAP1S Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAP1S. This antibody reacts with human. The MAP1S Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MAP1S antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GFGVPRHDPLPDPLKVPPPLPDPSSICMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSAR |
|---|
| Other Names | BPY2 interacting protein 1, BPY2IP1VCY2IP-1, C19orf5, chromosome 19 open reading frame 5, FLJ10669, MAP8MAP-1S, MGC133087, microtubule-associated protein 1S, Microtubule-associated protein 8, Variable charge Y chromosome 2-interacting protein 1, VCY2 interacting protein 1, VCY2-interacting protein 1, VCY2IP1BPY2-interacting protein 1 |
|---|
| Gene, Accession # | MAP1S, Gene ID: 55201 |
|---|
| Catalog # | NBP2-48987 |
|---|
| Price | |
|---|
| Order / More Info | MAP1S Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|