| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CARD8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CARD8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CARD8. This antibody reacts with human. The CARD8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CARD8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLA |
|---|
| Other Names | Apoptotic protein NDPP1, CARD inhibitor of NF-kappaB-activating ligands, CARDINALFLJ18121, CARD-inhibitor of NF-kappa-B-activating ligand, caspase recruitment domain family, member 8, caspase recruitment domain-containing protein 8, DACAR, Dakar, KIAA0955DKFZp779L0366, NDPP, NDPP1MGC57162, TUCANFLJ18119, Tumor up-regulated CARD-containing antagonist of CASP9, tumor up-regulated CARD-containing antagonist of caspase nine |
|---|
| Gene, Accession # | CARD8, Gene ID: 22900 |
|---|
| Catalog # | NBP2-47527 |
|---|
| Price | |
|---|
| Order / More Info | CARD8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|