| Edit |   |
|---|
| Antigenic Specificity | Acid Phosphatase 6, Lysophosphatidic (ACP6) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ACP6 could hydrolyze lysophosphatidic acid to monoacylglycerol. It was originally reported to be located in the mitochondrion, but the evidence seems to be weak and contradictory with the presence of a cleaved signal sequence. |
|---|
| Immunogen | ACP6 antibody was raised using the N terminal of ACP6 corresponding to a region with amino acids EQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFA |
|---|
| Other Names | ACP6|im:7147584|zgc:172268|MGC146066|ACPL1|LPAP|PACPL1|5730559A09Rik|AU022842|mPACPL1 |
|---|
| Gene, Accession # | Gene ID: 51205 |
|---|
| Catalog # | ABIN631264 |
|---|
| Price | |
|---|
| Order / More Info | Acid Phosphatase 6, Lysophosphatidic (ACP6) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|