| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MRP2/ABCC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | IHC-P, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for MRP2/ABCC2 detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Multidrug resistance-associated protein 2 (MRP2), also called canalicular multispecific organic anion transporter 1 (cMOAT) or ATP-binding cassette sub-family C member 2 (ABCC2), is a protein that in humans is encoded by the ABCC2 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human MRP2/ABCC2(AIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD). |
|---|
| Other Names | Canalicular multispecific organic anion transporter 1; ATP-binding cassette sub-family C member 2; Canalicular multidrug resistance protein; Multidrug resistance-associated protein 2; ABCC2; CMOAT; CMOAT1; CMRP; MRP2 |
|---|
| Gene, Accession # | ABCC2, UniProt: Q92887 |
|---|
| Catalog # | A00974-1 |
|---|
| Price | |
|---|
| Order / More Info | MRP2/ABCC2 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|