| Edit |   |
| Antigenic Specificity | KLHL8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KLHL8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLHL8. This antibody reacts with human. The KLHL8 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human KLHL8. Peptide sequence MASDSMSSKQARNHITKGKRQQQHQQIKNRSSISDGDGEDSFIFEANEAW. |
| Other Names | kelch-like 8 (Drosophila), kelch-like protein 8, KIAA1378FLJ46304 |
| Gene, Accession # | KLHL8, Gene ID: 57563, Accession: NP_065854, SwissProt: NP_065854 |
| Catalog # | NBP1-80346 |
| Price | |
| Order / More Info | KLHL8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |