| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SCN3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SCN3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to SCN3A. This antibody reacts with human. The SCN3A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SCN3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NRRKKRRQREHLEGNNKGERDSFPKSESEDSVKRSSFLFSMDGNRLTS |
|---|
| Other Names | brain III voltage-gated sodium channel, KIAA1356, NAC3, Nav1.3, Sodium channel protein brain III subunit alpha, sodium channel protein type 3 subunit alpha, Sodium channel protein type III subunit alpha, sodium channel, voltage-gated, type III, alpha polypeptide, sodium channel, voltage-gated, type III, alpha subunit, Voltage-gated sodium channel subtype III, Voltage-gated sodium channel subunit alpha Nav1.3 |
|---|
| Gene, Accession # | SCN3A, Gene ID: 6328, Accession: Q9NY46, SwissProt: Q9NY46 |
|---|
| Catalog # | NBP2-34003 |
|---|
| Price | |
|---|
| Order / More Info | SCN3A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|