| Edit |   |
|---|
| Antigenic Specificity | Lactamase, beta (LACTB) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins. |
|---|
| Immunogen | Beta Lactamase antibody was raised using the C terminal of LACTB corresponding to a region with amino acids TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL |
|---|
| Other Names | BA3500|BA2507|PSPTO2834|PSPTO3594|G24|MRPL56|LACT-1|Lact1|Mrpl56|zgc:110419 |
|---|
| Gene, Accession # | Gene ID: 114294,80907,300803 |
|---|
| Catalog # | ABIN631015 |
|---|
| Price | |
|---|
| Order / More Info | Lactamase, beta (LACTB) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|