| Edit |   |
|---|
| Antigenic Specificity | EH-Domain Containing 4 (EHD4) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway. |
|---|
| Immunogen | EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT |
|---|
| Other Names | EHD4|past4|PAST4|2210022F10Rik|AI197390|AI846352|AV006278|Past2 |
|---|
| Gene, Accession # | Gene ID: 30844,98878,192204 |
|---|
| Catalog # | ABIN631253 |
|---|
| Price | |
|---|
| Order / More Info | EH-Domain Containing 4 (EHD4) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|