| 产品详情 |
| Edit |   |
| Antigenic Specificity | BRUNOL5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BRUNOL5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BRUNOL5. This antibody reacts with human. The BRUNOL5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human BRUNOL5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AQSPTVAETLHPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQ |
| Other Names | Bruno (Drosophila) -like 5, RNA binding protein, BRUNOL-5, BRUNOL5bruno-like 5, RNA binding protein (Drosophila), bruno-like 5 RNA binding protein, Bruno-like protein 5, CELF-5, CUG-BP and ETR-3 like factor 5, CUG-BP- and ETR-3-like factor 5, CUGBP Elav-like family member 5, CUGBP, Elav-like family member 5, RNA-binding protein BRUNOL-5 |
| Gene, Accession # | CELF5, Gene ID: 60680, Accession: Q8N6W0, SwissProt: Q8N6W0 |
| Catalog # | NBP2-34134 |
| Price | |
| Order / More Info | BRUNOL5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|