| Edit |   |
|---|
| Antigenic Specificity | FAM110D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 89%, rat 87%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human FAM110D polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: HQVIARRQEPALRGSPGPLTPHPCNELGPPASPRTPRPVRRGSGRRLPRPDSLIFYRQKRDC |
|---|
| Other Names | family with sequence similarity 110, member D, FLJ14050, GRRP1 |
|---|
| Gene, Accession # | Gene ID: 79927, UniProt: Q8TAY7, ENSG00000197245 |
|---|
| Catalog # | HPA013664 |
|---|
| Price | |
|---|
| Order / More Info | FAM110D Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|