| Edit |   |
|---|
| Antigenic Specificity | CTBP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat (antigen sequence identity: mouse 97%, rat 95%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human CTBP1 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: YPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL |
|---|
| Other Names | C-terminal binding protein 1, BARS |
|---|
| Gene, Accession # | Gene ID: 1487, UniProt: Q13363, ENSG00000159692 |
|---|
| Catalog # | HPA018987 |
|---|
| Price | |
|---|
| Order / More Info | CTBP1 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|