| Edit |   |
|---|
| Antigenic Specificity | Carbonic Anhydrase VIII (CA8) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CA8 was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, CA8 lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). CA8 continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. |
|---|
| Immunogen | Carbonic Anhydrase VIII antibody was raised using the middle region of CA8 corresponding to a region with amino acids TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ |
|---|
| Other Names | AW546993|Ca8|Cals|Cals1|Carp|wdl|zgc:110118|CA-VIII|CALS|CAMRQ3|CARP |
|---|
| Gene, Accession # | Gene ID: 767,12319,297814 |
|---|
| Catalog # | ABIN631159 |
|---|
| Price | |
|---|
| Order / More Info | Carbonic Anhydrase VIII (CA8) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|