| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Carbonic Anhydrase XII/CA12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carbonic Anhydrase XII/CA12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carbonic Anhydrase XII/CA12. This antibody reacts with human. The Carbonic Anhydrase XII/CA12 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Carbonic Anhydrase XII/CA12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAEL |
|---|
| Other Names | Carbonate dehydratase XII, carbonic anhydrase 12, carbonic anhydrase XIICAXII, carbonic dehydratase, CA-XII, EC 4.2.1.1, FLJ20151, HsT18816, Tumor antigen HOM-RCC-3.1.3 |
|---|
| Gene, Accession # | CA12, Gene ID: 771 |
|---|
| Catalog # | NBP2-57791 |
|---|
| Price | |
|---|
| Order / More Info | Carbonic Anhydrase XII/CA12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|