| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Alpha-mannosidase II |
|---|
| Clone | 1G9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Alpha-mannosidase II Antibody (1G9) from Novus Biologicals is a mouse monoclonal antibody to Alpha-mannosidase II. This antibody reacts with human. The Alpha-mannosidase II Antibody (1G9) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | MAN2A1 (NP_002363 1045 a.a. - 1144 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQLR |
|---|
| Other Names | alpha-mannosidase 2, AMan II, EC 3.2.1, EC 3.2.1.114, Golgi alpha-mannosidase II, golgi integral membrane protein 7, GOLIM7, Man II, MANA2MANII, Mannosidase alpha class 2A member 1, mannosidase, alpha type II, mannosidase, alpha, class 2A, member 1, Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase |
|---|
| Gene, Accession # | MAN2A1, Gene ID: 4124, Accession: NP_002363, SwissProt: NP_002363 |
|---|
| Catalog # | H00004124-M01 |
|---|
| Price | |
|---|
| Order / More Info | Alpha-mannosidase II Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 19564412, 21332221 |
|---|
| 产品资料 |
|
|