| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ELAVL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ELAVL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ELAVL2. This antibody reacts with human. The ELAVL2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ELAVL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MAVRLCDVASLLRSGSWAAEPWTGQVIAAMETQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNL |
|---|
| Other Names | ELAV (embryonic lethal, abnormal vision, Drosophila)-like 2 (Hu antigen B), ELAV-like neuronal protein 1, ELAV-like protein 2, HELN1, HEL-N1, Hu-antigen B, HuB, HUBELAV (embryonic lethal, abnormal vision, Drosophila)-like 2, Nervous system-specific RNA-binding protein Hel-N1 |
|---|
| Gene, Accession # | ELAVL2, Gene ID: 1993 |
|---|
| Catalog # | NBP2-38012 |
|---|
| Price | |
|---|
| Order / More Info | ELAVL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|