| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ELAVL4 |
|---|
| Clone | 6B9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin, RNA Inhibition. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ELAVL4 Antibody (6B9) from Novus Biologicals is a mouse monoclonal antibody to ELAVL4. This antibody reacts with human, rat. The ELAVL4 Antibody (6B9) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin, RNA Inhibition. |
|---|
| Immunogen | ELAVL4 (NP_068771 312 a.a. - 380 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS |
|---|
| Other Names | abnormal vision, Drosophila, homolog of, like-4, ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D), HuD, Paraneoplastic encephalomyelitis antigen HuD |
|---|
| Gene, Accession # | ELAVL4, Gene ID: 1996, Accession: NP_068771, SwissProt: NP_068771 |
|---|
| Catalog # | H00001996-M01 |
|---|
| Price | |
|---|
| Order / More Info | ELAVL4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28466581 |
|---|
| 产品资料 |
|
|