| Edit |   |
|---|
| Antigenic Specificity | Disrupted in Renal Carcinoma 2 (DIRC2) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DIRC2 is a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of DIRC2 by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined. |
|---|
| Immunogen | DIRC2 antibody was raised using the middle region of DIRC2 corresponding to a region with amino acids AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ |
|---|
| Other Names | MGC80843|zgc:92095|rcc4|MGC69320|RCC4 |
|---|
| Gene, Accession # | Gene ID: 84925,224132 |
|---|
| Catalog # | ABIN635117 |
|---|
| Price | |
|---|
| Order / More Info | Disrupted in Renal Carcinoma 2 (DIRC2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|