| Edit |   |
|---|
| Antigenic Specificity | BRX1, Biogenesis of Ribosomes, Homolog (S. Cerevisiae) (BRIX1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | BXDC2 is required for biogenesis of the 60S ribosomal subunit. |
|---|
| Immunogen | BXDC2 antibody was raised using the middle region of Bxdc2 corresponding to a region with amino acids ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA |
|---|
| Other Names | BXDC2|brix|bxdc2|BRIX|1110064N10Rik|Bxdc2|C76935|RGD1308508 |
|---|
| Gene, Accession # | Gene ID: 55299 |
|---|
| Catalog # | ABIN631990 |
|---|
| Price | |
|---|
| Order / More Info | BRX1, Biogenesis of Ribosomes, Homolog (S. Cerevisiae) (BRIX1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|