| Edit |   |
|---|
| Antigenic Specificity | PCGF3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 98%, rat 98%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human PCGF3 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFI |
|---|
| Other Names | polycomb group ring finger 3, DONG1, FLJ36550, MGC40413, RNF3, RNF3A |
|---|
| Gene, Accession # | Gene ID: 10336, UniProt: Q3KNV8, ENSG00000185619 |
|---|
| Catalog # | HPA061879 |
|---|
| Price | |
|---|
| Order / More Info | PCGF3 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|