| Edit |   |
| Antigenic Specificity | Carnitine O-Acetyltransferase (CRAT) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Carnitine acetyltransferase (CRAT) is a key enzyme in the metabolic pathway in mitochondria, peroxisomes and endoplasmic reticulum. CRAT catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acylCoA/CoA in the subcellular compartments. Different subcellular localizations of the CRAT mRNAs are thought to result from alternative splicing of the CRAT geneuggested by the divergent sequences in the 5' region of peroxisomal and mitochondrial CRAT cDNAs and the location of an intron where the sequences diverge. |
| Immunogen | CRAT antibody was raised using the N terminal of CRAT corresponding to a region with amino acids MKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVD |
| Other Names | AW107812|CARAT|CAT1 |
| Gene, Accession # | Gene ID: 1384 |
| Catalog # | ABIN630518 |
| Price | |
| Order / More Info | Carnitine O-Acetyltransferase (CRAT) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |