| Edit |   |
|---|
| Antigenic Specificity | Armadillo Repeat Containing, X-Linked 3 (ARMCX3) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ARMCX3 is a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. |
|---|
| Immunogen | ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE |
|---|
| Other Names | ARMCX3|DKFZp459E2029|ALEX3|dJ545K15.2|1200004E24Rik|AI450003 |
|---|
| Gene, Accession # | Gene ID: 51566 |
|---|
| Catalog # | ABIN635988 |
|---|
| Price | |
|---|
| Order / More Info | Armadillo Repeat Containing, X-Linked 3 (ARMCX3) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|