| Edit |   |
|---|
| Antigenic Specificity | CFC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 29%, rat 33%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human CFC1 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: YQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYS |
|---|
| Other Names | cripto, FRL-1, cryptic family 1, CRYPTIC, HTX2 |
|---|
| Gene, Accession # | Gene ID: 55997, UniProt: P0CG37, ENSG00000136698 |
|---|
| Catalog # | HPA041773 |
|---|
| Price | |
|---|
| Order / More Info | CFC1 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|