Edit |   |
Antigenic Specificity | AMY1A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 76%, rat 80%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human AMY1A polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRL |
Other Names | amylase, alpha 1A (salivary), AMY1 |
Gene, Accession # | Gene ID: 276, UniProt: P04745, ENSG00000237763 |
Catalog # | HPA046980 |
Price | |
Order / More Info | AMY1A Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |