| Edit |   |
|---|
| Antigenic Specificity | IDNK |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 53%, rat 55%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human IDNK polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREGH |
|---|
| Other Names | idnK, gluconokinase homolog (E. coli), bA522I20.2, C9orf103 |
|---|
| Gene, Accession # | Gene ID: 414328, UniProt: Q5T6J7, ENSG00000148057 |
|---|
| Catalog # | HPA058429 |
|---|
| Price | |
|---|
| Order / More Info | IDNK Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|