| Edit |   |
|---|
| Antigenic Specificity | TSACC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 52%, rat 71%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, WB. Recombinant expression validation in WB using target protein overexpression. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human TSACC polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLG |
|---|
| Other Names | TSSK6 activating co-chaperone, C1orf182, SIP, SSTK-IP |
|---|
| Gene, Accession # | Gene ID: 128229, UniProt: Q96A04, ENSG00000163467 |
|---|
| Catalog # | HPA029897 |
|---|
| Price | |
|---|
| Order / More Info | TSACC Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|