| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | N-WASP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in the literature (PMID:28351346). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The N-WASP Antibody from Novus Biologicals is a rabbit polyclonal antibody to N-WASP. This antibody reacts with human, mouse, rat. The N-WASP Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRS |
|---|
| Other Names | N-WASPneural WiskNWASP, WiskDKFZp779G0847, WiskMGC48327 |
|---|
| Gene, Accession # | WASL, Gene ID: 8976 |
|---|
| Catalog # | NBP1-82512-25ul |
|---|
| Price | |
|---|
| Order / More Info | N-WASP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23091069, 23471198, 28351346 |
|---|
| 产品资料 |
|
|