Edit |   |
Antigenic Specificity | ABCC1 (N-terminus) |
Clone | CBFYM-0808 |
Host Species | Recombinant Mouse |
Reactive Species | human, mouse |
Isotype | IgG1 |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse Anti-ABCC1 (N-terminus) Recombinant Antibody (CBFYM-0808). This product is mouse antibody that recognizes ABCC1. The antibody CBFYM-0808 can be used for immunoassay techniques such as: WB. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies. This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate |
Immunogen | Recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. |
Other Names | ATP Binding Cassette Subfamily C Member 1; ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1; Leukotriene C(4) Transporter; LTC4 Transporter; MRP1; MRP; ATP-Binding Cassette Transporter Variant ABCC1delta-Ex13&14; ATP-Binding Cassette Transporter Variant ABCC1delta-Ex25&26; ATP-Binding Cassette Transporter Variant ABCC1delta-Ex13; ATP-Binding Cassette Transporter Variant ABCC1delta-Ex25 |
Gene, Accession # | Gene ID: 4363, UniProt: P33527 |
Catalog # | CBMAB-M0953-FY |
Price | |
Order / More Info | ABCC1 (N-terminus) Antibody from CREATIVE BIOLABS |
Product Specific References | n/a |