| Edit |   |
|---|
| Antigenic Specificity | EXOC6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 63%, rat 56%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human EXOC6 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE |
|---|
| Other Names | exocyst complex component 6, DKFZp761I2124, EXOC6A, FLJ1125, MGC33397, SEC15L, SEC15L1, Sec15p |
|---|
| Gene, Accession # | Gene ID: 54536, UniProt: Q8TAG9, ENSG00000138190 |
|---|
| Catalog # | HPA036285 |
|---|
| Price | |
|---|
| Order / More Info | EXOC6 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|