Edit |   |
Antigenic Specificity | ABCG4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 88%, rat 92%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human ABCG4 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDPIESHTFATSTLT |
Other Names | ATP-binding cassette, sub-family G (WHITE), member 4, WHITE2 |
Gene, Accession # | Gene ID: 64137, UniProt: Q9H172, ENSG00000172350 |
Catalog # | HPA040312 |
Price | |
Order / More Info | ABCG4 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |