Edit |   |
Antigenic Specificity | CCDC184 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 80%, rat 82%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF, IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human CCDC184 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EEEKEMPSPATPSSHCERPESPCAGLLGGDGPLVEPLDMPDITLLQLEGEA |
Other Names | coiled-coil domain containing 184, C12orf68, LOC387856 |
Gene, Accession # | Gene ID: 387856, UniProt: Q52MB2, ENSG00000177875 |
Catalog # | HPA041715 |
Price | |
Order / More Info | CCDC184 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |