Edit |   |
Antigenic Specificity | CCDC190 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 48%, rat 47%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human CCDC190 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KDVDPSKGISVPCQNQEVSTNTIEQGPSSSPASDSGMACADETRSKDVALKPDGNTGKQI |
Other Names | coiled-coil domain containing 190, C1orf110, MGC48998 |
Gene, Accession # | Gene ID: 339512, UniProt: Q86UF4, ENSG00000185860 |
Catalog # | HPA028579 |
Price | |
Order / More Info | CCDC190 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |