| Edit |   |
|---|
| Antigenic Specificity | KLK7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 66%, rat 68%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Recombinant expression validation in WB using target protein overexpression. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human KLK7 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: AHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSM |
|---|
| Other Names | kallikrein-related peptidase 7, PRSS6, SCCE |
|---|
| Gene, Accession # | Gene ID: 5650, UniProt: P49862, ENSG00000169035 |
|---|
| Catalog # | HPA062126 |
|---|
| Price | |
|---|
| Order / More Info | KLK7 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|