Edit |   |
Antigenic Specificity | ORAI1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 95%, rat 95%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human ORAI1 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHYA |
Other Names | ORAI calcium release-activated calcium modulator 1, CRACM1, FLJ14466, TMEM142A |
Gene, Accession # | Gene ID: None, UniProt: None, ENSG00000276045 |
Catalog # | HPA016583 |
Price | |
Order / More Info | ORAI1 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |