| Edit |   |
|---|
| Antigenic Specificity | ADCY2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 98%, rat 98%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human ADCY2 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: HISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGAK |
|---|
| Other Names | adenylate cyclase 2 (brain), AC2, HBAC2, KIAA1060 |
|---|
| Gene, Accession # | Gene ID: 108, UniProt: Q08462, ENSG00000078295 |
|---|
| Catalog # | HPA038483 |
|---|
| Price | |
|---|
| Order / More Info | ADCY2 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|